PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI04G22380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 343aa    MW: 37110.9 Da    PI: 7.9186
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI04G22380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.25.8e-113176146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde l++ v+ +G+ +W++I ++  + Rt+k+c++rw +
  ORUFI04G22380.1 31 KGPWMAEEDEVLLEHVRTHGPMDWSSIRSKGLLPRTGKSCRLRWVN 76
                     79******************99*****8876677**********87 PP

2Myb_DNA-binding43.38.8e-1487127345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T+eE+   +++ +q+G++ W++Ia +++ gRt++++k++w 
  ORUFI04G22380.1  87 KFTAEEERVVIELQAQFGNK-WARIATYLQ-GRTDNDVKNFWS 127
                      79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.3572678IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-192879IPR009057Homeodomain-like
SuperFamilySSF466895.86E-2629126IPR009057Homeodomain-like
SMARTSM007176.6E-93080IPR001005SANT/Myb domain
CDDcd001673.95E-103378No hitNo description
PfamPF139211.8E-103483No hitNo description
PROSITE profilePS5129420.31979134IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-1880132IPR009057Homeodomain-like
SMARTSM007179.7E-1284132IPR001005SANT/Myb domain
CDDcd001672.88E-1087126No hitNo description
PfamPF002495.4E-1287127IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MARAPGGVRR RSGRRGAGGG GAGGGGEALR KGPWMAEEDE VLLEHVRTHG PMDWSSIRSK  60
GLLPRTGKSC RLRWVNKLRP NLKSGCKFTA EEERVVIELQ AQFGNKWARI ATYLQGRTDN  120
DVKNFWSTRQ KRLARLLRGP LPAARPNKHN SGKGKAPSSS SLDSQTATFH QSSASLDQAS  180
LEGNSLGWQC REAAPFMGYD QACSGFFAFE GPLPLQLLPP ADGEASSSNA AQSAPPPLLF  240
DQPPYPLINF PGWPERYVDV GHGFVDAGAM DGLAYQELLP MVQSVPMIMP FFGMECAHDA  300
VKHGAFDDLP PNMFDDAVDQ PPPPPPPPPP PSPSPSPSRD DVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-252913225126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR8552180.0CR855218.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0106P14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634881.10.0PREDICTED: myb-related protein MYBAS2-like, partial
TrEMBLA0A0D9ZNW20.0A0A0D9ZNW2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0H3W50.0A0A0E0H3W5_ORYNI; Uncharacterized protein
TrEMBLA0A0E0H3W80.0A0A0E0H3W8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PCC00.0A0A0E0PCC0_ORYRU; Uncharacterized protein
TrEMBLA2XW630.0A2XW63_ORYSI; Putative uncharacterized protein
TrEMBLQ0JB890.0Q0JB89_ORYSJ; Os04g0549500 protein
STRINGBGIOSGA016880-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g46384.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.14e-57MYB family protein